PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G138400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 554aa    MW: 60679.9 Da    PI: 4.3644
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G138400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK54.42.4e-17441490352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +++ +ed+ k+ +++ kdAAk+L+++ T LKr CR+++ +RWP Rki s+
  Sevir.1G138400.1.p 441 SDVAMEDILKCLHMSKKDAAKKLNISSTSLKRLCRKNNTNRWPGRKIISI 490
                         67899******************************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.709423510IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.100.001428479IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF020425.2E-17443489IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MSDEAYDSDG DVIRFLQIVL PPESHLLAEP SDVPVASHVG APQDAPAAVQ MGMALQTPSL  60
NPDPAFGFPA PTTDIENHQA LATDVASHVI VAPQDVPAVQ MDMALERLPP PPNPDLAFGF  120
PAQTTDDVEN NQALVMDEQP PQAYGFPDDP VPSVMASNDP MPSFETLFDD DIVLSNLGAM  180
SLHGDQFMDD DGDEDEFEAF IRSIEDDAGH TNMGSAIAEH TVPRVEDMNF VPFVLGELDC  240
SNCRSVREML HEGANHKLHF DVHVVELGTF QHAIFDRTYI DANGETILNE KVYFDLRQRT  300
HEWVQNFIDN RVEMLKNDTS GQLKDSCSTF SAAVCTNISM PANNDDAHRE LEMDMLRKIF  360
SSPTAPTEAV GPQFAPEGAQ PATRAEENIN ADDILFDAAN WPGAGLSPAI LESCQIAVQD  420
GVSSASAADY SLLEKERKRN SDVAMEDILK CLHMSKKDAA KKLNISSTSL KRLCRKNNTN  480
RWPGRKIISI DNKIKKLEQA AQRNVGTTGL LTIKEKLDKL RFERAQLYAP IMNGTCTQEN  540
KKHNGDAGPS VSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444338.11e-147hypothetical protein SORBIDRAFT_07g020410
TrEMBLK3YZQ90.0K3YZQ9_SETIT; Uncharacterized protein
STRINGSi019769m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144291012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.12e-11Nin-like family protein